Genesis theme WordPress - WordPress site: actividadesdeinfantilyprimaria.com
Last updated Sep 2026
Page title: Actividades de infantil y primaria - Recursos para trabajar en infantil y primaria
Page description: Recursos para trabajar en infantil y primaria
Detected WordPress themes (2x)
WordPress theme Genesis by StudioPress. The industry standard for Premium WordPress Themes.
Hello Pro WordPress blog theme by brandiD. Creating an eye-catching, attention-grabbing, personal branded site can help you make your best online first impression. And that…can make all the difference in the world wide web. With over 250 million web and blog sites on the Internet making a lasting impression on the web is super important. Be distinct and start building your brand online.
Detected WordPress plugins (3x)
342 172Jetpack – WP Security, Backup, Speed, & Growth
The most popular WordPress plugin for just about everything. WordPress security, performance, marketing, and design tools — Jetpack is made by WordPress experts to make...
1 747 449
709 463Site Kit by Google – Analytics, Search Console, AdSense, Speed
Site Kit is the official WordPress plugin from Google for insights about how people find and use your site. Site Kit is the one-stop solution to deploy, manage, and get...Discover top-level information for this domain
| Hosting provider: | OVH SAS |
| Domain registrator: | dondominio.com |
| Domain IP: | 164.132.249.200 |
| Hosting location: | Spain |
