Fort Langley Farmers Market WordPress theme - WordPress site: fortlangleyvillagefarmersmarket.org
Last updated Oct 2026
Page title: Vendor & Market Member Registration | Fort Langley Saturday Farmers' Market open April 18th 2026, 9:00am to 3:00pm
Page description: Providing Local BC Farm Produce, and BC Prepared Foods:Fort Langley Village Farmers’ Market is an authentic B.C. Farmers’ Market and features Local Organic Farms and Certified Safe BC Prepared Foo
Detected WordPress theme (1x)
WordPress theme Fort Langley Farmers Market by Manus AI. A modern, responsive theme for the Fort Langley Farmers Market.
Detected WordPress plugins (4x)
69 806Free
Smush – Lazy Load Images, Optimize & Compress Images
Optimize images, turn on lazy load, resize, compress & improve your Google Page Speed with the incredibly powerful and 100% free WordPress image smusher, brought to...
5 828FreeUse Superb Gutenberg Blocks to add new awesome features to the WordPress editor in seconds! Superb Gutenberg Blocks is GDPR compliant, lightweight and responsive. The...
479Free
Superb WordPress Table (SEO Optimized Tables With Schema)
Responsive & SEO Optimized tables. Get your Google Featured Snippets. Different table designs, table shortcodes & lightweight code. Click here to view the demo!...
110 280PremiumYoast SEO for WordPress makes SEO accessible for everyone. Start ranking nowWhat is Yoast SEO Premium?Yoast SEO Premium makes SEO a breeze. Works out of the box, and will...
Discover top-level information for this domain
| Hosting provider: | IWEB-AS |
| Domain registrator: | hostutopia.net |
| Domain IP: | 64.15.146.165 |
| Hosting location: | Canada |
