Meritorious premium WordPress theme - WordPress site: centralpennsylvaniatrafficlawyers.com

Last updated Oct 2026

Page title: Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100

Page description: Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work

Detected WordPress theme (1x)

More Info / Download Theme

Get Hosting *

Theme name:	Meritorious
Author:	Benjamin Lu
Theme used on:	10 websites
Theme folder:	meritorious
Last version:	1.0.1*
Author homepage:	getbenonit.com
Theme homepage:	getbenonit.com/portfolio/meritorious

Meritorious WordPress theme by Benjamin Lu. Meritorious is a theme that allows you to write anything you want.

Detected WordPress plugin (1x)

1 747 073

Free

Yoast SEO

by Team Yoast

Yoast SEO: the #1 WordPress SEO plugin Since 2008 Yoast SEO has helped millions of websites worldwide to rank higher in search engines. Yoast’s mission is SEO for...

Discover top-level information for this domain

Hosting provider:	Akamai International B.V.
Domain registrator:	parklogic.com
Domain IP:	172.237.129.108
Hosting location:	United States